PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 1698aa    MW: 185022 Da    PI: 6.0602
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496318.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.11.7e-07793834346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e++++ ++ +G++ + +Ia+ +  ++t  +c+++++k
   XP_004496318.1 793 PWTSEEREIFLEKFAAFGKD-FCKIASFLD-HKTTADCVEFYYK 834
                      8*****************99.*********.***********98 PP

2Myb_DNA-binding35.91.7e-1110091051347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                        WT +E   +++av  +G++ +++Iar++g +R++++ck ++ k 
   XP_004496318.1 1009 DWTDDEKAAFLQAVSSFGKD-FAKIARCVG-TRSREHCKVFFSKT 1051
                       5*****************99.*********.********988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.44E-14777838IPR009057Homeodomain-like
PROSITE profilePS5129316.147789840IPR017884SANT domain
SMARTSM007175.9E-9790838IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-5793834IPR009057Homeodomain-like
PROSITE profilePS5129312.82510051056IPR017884SANT domain
SMARTSM007171.5E-710061054IPR001005SANT/Myb domain
SuperFamilySSF466896.55E-1010081055IPR009057Homeodomain-like
PfamPF002495.0E-910091049IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-610091050IPR009057Homeodomain-like
CDDcd001677.60E-710101048No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1698 aa     Download sequence    Send to blast
MPPEPLPWDR KDFFKERKHD RSESLGSVAR WRDSSHHRDF NRWGSAEFRR PPGHGKQGGW  60
HMFSEEPGHG YGVSRSGDKS MEEDSRPSVS RGDGKYGRSS RDNRGSFGQR DWRGHSWEVT  120
NGSPNLSRRP PDMNNDQRSV DDSLTYSSHP HSDFVNTWEQ HHLKDQHEKM GGVNGLVTGP  180
RCDRENSLGS IDWKPLKWTR SGSLSSRGSG FSHSSSSRSM AGADSYEAKP DLQPKNVTTI  240
ESHSGEATAC VTSSMPLEDT TSRKKPRLNW GEGLAKYEKK KVEVPDPGAS KEDGPVNMEP  300
CNLISPNLVD KSPKVTGFSE CASPATPSSV ACSSSPGVDD KLSGKTANAD NNVSNLTESP  360
APGFQNHLQR FYLNLEKLDI DSLNNLGSSI VELVQSDDPS SDDSGLVRSN AINKLLIWKA  420
DISKVLEMTE SEIDLLENEL KSLKSSVDRY QCPVALGSQQ EGSSLKFYEG VEVSQKVIRP  480
EPLIIISSDE PNIEKMPQST NLIVHENDKE EDIDSPGSAT SKFVEPPPSV KAVSSCDTGE  540
CYNLSGDMDT IQPTTIKCLV RCTTRKDASV SACNDVNTST EIKDSLDDTT FGASLCSSYE  600
DTYNSIIASN KESANRAHDV FAKLLPKECN KLGNMGVSND SSSHTLIMEK FAKKKRFERF  660
KERIIALKFK ALHHLWKEDM RLLSNRKCRP KSHKKNELSV RTTCSSNLKN RSSIRSRFPF  720
PAGNHLSLVP TSEIINFTGK LLSESQAPLQ RNTLKMPSLI LDEKEKMVSK FISSNGLVED  780
PLAIEKERAM INPWTSEERE IFLEKFAAFG KDFCKIASFL DHKTTADCVE FYYKNHKSEC  840
FEKLKRKDVG KLGKSFAAKS NLMASGKKWN HEVNVSSLDI LSAASVMADG IAGNKRMRAG  900
RFLLGGYGNV KASRGEDVNI ERSNSFDILA DERETAAAAD VLAGICGSLS SEAMSSCITS  960
SVDPVDGNKE RNFLKAKPLY KQPLTPDFSQ NADDDSCSDE SCGEVDLSDW TDDEKAAFLQ  1020
AVSSFGKDFA KIARCVGTRS REHCKVFFSK TRKVLGLDVA HPLPGIVGSP LNDDANGGES  1080
DTDDACVVET GSVVDADKSG NKTDEDLPSG VNTLHDESNP LEARNLSAEL NESREITGTE  1140
VCLENVGVDS NVFAIKVESG LGSDGSGVVL GKSDMTGSVN GQSAILTSDS IEVAKGEAYK  1200
LGDAIRESIS TPGIIEPWEC GSVAVDRPFS DVSSGDLGNE VERQKVIAPQ CVDDIDNKHE  1260
ADEGIVVELK SCVLESSTAA NVSFSSVVNS CSGLSFGTEN KPVSLGKPHI PALSTKDSRA  1320
TANSLLQKAA AAQCEKTVSQ DRLSSTCDIQ EGRDMRCHSS GSNGDHQLPL PGNHVGTVGI  1380
LQGYPLRGAI KEEVDGVMNC SNSATELPLL PQKAKQTDDH FKTTWHSSDS DKTPRNGDVK  1440
LFGKILTNPS STQKPSLISK GSEENGTHYP KLSNKSSNLK FTGHHNSDGN LKFLKFDRSD  1500
YLGLENVPVM GYGYWEGNGI QTIQTGLSSL PDSSFLLAKY PAAFSTYPSS SSSKLEQQPL  1560
QAFAKNNERH LSGSSAFTAR DINGSNAMID YQMFRSRDGP KVQPFMVDVK HCQNVFSEMQ  1620
RRNSFEAISS LQQQGRGMMG MNSVGRPGIL VGGGSCSGVS DPVAAIKMHY SNSDMYGGQN  1680
GSIVRDDESW GGKGDLGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-17751842494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-17751842494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1260150.0AC126015.41 Medicago truncatula clone mth2-13l2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496318.10.0PREDICTED: uncharacterized protein LOC101504689 isoform X1
TrEMBLG7I9K50.0G7I9K5_MEDTR; Myb DNA-binding domain protein
STRINGGLYMA20G31871.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-86MYB family protein